PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC014971.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB_related
Protein Properties Length: 766aa    MW: 82915.9 Da    PI: 5.0594
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC014971.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.31.7e-085292345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                      WT  E   + +av  +G++ +++I+r +g +R+  qc+ ++ 
     EcC014971.10 52 DWTDREKSAFMRAVSSYGKD-FALISRFVG-TRSVDQCRVFFS 92
                     5*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129313.6964899IPR017884SANT domain
SMARTSM007173.2E-74997IPR001005SANT/Myb domain
SuperFamilySSF466891.2E-1050100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-55193IPR009057Homeodomain-like
PfamPF002492.3E-75292IPR001005SANT/Myb domain
CDDcd001671.32E-65391No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001522Biological Processpseudouridine synthesis
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
GO:0009982Molecular Functionpseudouridine synthase activity
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
VTSSVDPGEG GRELKCSKVD FVRKRPFTPE FMENVEEETC SGESSGEMDA SDWTDREKSA  60
FMRAVSSYGK DFALISRFVG TRSVDQCRVF FSKARKCLNL DSLLPICGSR GTPVSEDANG  120
DGDMEDACGL EISSAICGDK LSSKMDEDLV VKDVNQVESD CKSLNFGDDL NKSDGNTGSG  180
ELSCEYVKDM EIAVPDVCQM RDGDEVVSKG VGSISASVGT QKSIADSDVT RVEATVAVGA  240
SLIESSVRED TDHGSCFSAS ADGEHAIRAC TEGFKNITWG QEALLPQKCN GDTTHPSSLL  300
SSSGESDTQI NSSRLPADRS PCFGFSHRSE SEHQVSLVLD PVEISSSNSR HDEKFQGATR  360
SLSSDSAPNY CKISRTQDRM SSSDGPPTKE KHKQFVSNDD YYKHVSGSSL LSQMESPILP  420
GYPIQQLHAQ ENSGSTSGEF SDVQKHLKPE NSITCRYVVP DFHLKKCTTS KSHSSVAELP  480
LLPHKSEQLT GLSKIDMPSL PDSQKQSKSG DFKLFGQILS HPPSQPTPKV SVQDNDENGA  540
PQRKFGSKES DLKPSSNHSE GGNSAMLKFD CNNYAGLENV PLRTYGFWDG NRIQISSLPD  600
SALLLAKYPA AFSNFPLPTT KLEQHAMQPV PKSNECGLSG VSVFPSREVA NGNGIVDYRL  660
YRSRDDGKVQ PFAIDVKQRQ DACPELQRYN GFEAVSAGIQ HQGRGMIAMN VMGRGGMLGG  720
GPCNGVSDPV TAIKMQFAQS DPLVGHQNGN IVREEESWRG KGDVGR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067289.10.0PREDICTED: uncharacterized protein LOC104454203
TrEMBLA0A059BI880.0A0A059BI88_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-21MYB family protein